MetabolicUnregulated/Therapeutic
Cagrilintide
Synonyms: AM833
Sequence: KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2
History & Discovery Timeline
Cagrilintide was developed by Novo Nordisk as a long-acting amylin analog, designed to be co-formulated with semaglutide (CagriSema).
What it is: Cagrilintide is a synthetic peptide that acts as a long-acting amylin receptor agonist. It is classified under the Metabolic category.
Proposed Mechanisms & Research Findings: It binds to amylin and calcitonin receptors, promoting satiety, delaying gastric emptying, and working synergistically with GLP-1 agonists to enhance weight loss.
Regulatory & Safety Status: It is not FDA approved and is currently undergoing Phase III clinical trials. Sourcing unregulated forms online carries major risks of dosage inaccuracy and contamination.
Athletic & Anti-Doping Status: It is not prohibited by WADA, though it is monitored under weight-altering agents.
Understanding Cagrilintide Key Facts
Primary Target System:NEUROENDOCRINE
Residue Count / Length:2 Amino Acids
Primary Action & Category:Amylin Receptor Agonist (Metabolic)
Primary Receptors:Calcitonin Receptor (CTR), Amylin Receptors (AMY1, AMY2, AMY3)
Figure 1: Detailed molecular mechanism pathways of Cagrilintide (click to enlarge).